PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G380500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 548aa    MW: 60362.4 Da    PI: 6.4402
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G380500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS437.97.3e-1341775461373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l+elL++cA+av++++  +++ ++ +l++++s +g+p++Rl ay++e+L arla+s++++ykal+++e +   ss+ l+++++++e++P++
  Sevir.2G380500.1.p 177 LKELLIACARAVEQNNSFAIDLMIPELRKMVSVSGEPLERLGAYMVEGLVARLASSGNSIYKALKCKEPK---SSDLLSYMHFLYEACPYF 264
                         5799*****************************************************************9...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kf+++ aN aI eav+ge+r+HiiDf i qG+QW++LlqaLa+Rp+gpp +RiTg++++ s   +   le +g+rL+++A   +vpf+fn+
  Sevir.2G380500.1.p 265 KFGYMSANGAIAEAVKGEDRIHIIDFHIAQGAQWISLLQALAARPGGPPFVRITGIDDSVSAyaRGGGLELVGRRLSHIAGLYKVPFQFNA 355
                         **********************************************************888899999************************ PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          va + +++e  +L + pgEa+aVn+ l+lh+++de+vs++++rd++L+lvkslsPkv+++veqe+++n+++F++rf+e+l+yy+a+f+s+
  Sevir.2G380500.1.p 356 -VAISGNEMEEGHLGIVPGEAVAVNFTLELHHIPDETVSTANHRDRILRLVKSLSPKVLTLVEQESNTNTAPFAQRFAETLDYYTAIFESI 445
                         .6889999*********************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         +  lpre++eri++E+++l+reivn+vaceg+er+erhe ++kW++rl++aGF+p pls  +++++k+ll+ ++ d y++ e++g l+lgW
  Sevir.2G380500.1.p 446 DLALPREDRERINMEQHCLAREIVNLVACEGEERVERHEVFGKWKARLMMAGFRPSPLSALVNATIKTLLQSYSPD-YKLAERDGVLYLGW 535
                         **************************************************************************66.************** PP

                GRAS 363 kdrpLvsvSaW 373
                         k+rpL++ SaW
  Sevir.2G380500.1.p 536 KNRPLIVSSAW 546
                         *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.438151528IPR005202Transcription factor GRAS
PfamPF035142.5E-131177546IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MADTPTSRMV HPFGNVPRQT PKQFLYSGNT QHLCHPYQSA SDTHVVPQHH YTMKSHSPDA  60
VSEEHETRKQ YTLDSSAASG CSRHDSPSSQ SIHTGSGSPL SHEDSHSGST NGNGSPVSAS  120
CVTEDPTDLK QKLKDLEAVM LGTDSEIVDS LEISVANQLS LEPEKWVHMM SMPKGNLKEL  180
LIACARAVEQ NNSFAIDLMI PELRKMVSVS GEPLERLGAY MVEGLVARLA SSGNSIYKAL  240
KCKEPKSSDL LSYMHFLYEA CPYFKFGYMS ANGAIAEAVK GEDRIHIIDF HIAQGAQWIS  300
LLQALAARPG GPPFVRITGI DDSVSAYARG GGLELVGRRL SHIAGLYKVP FQFNAVAISG  360
NEMEEGHLGI VPGEAVAVNF TLELHHIPDE TVSTANHRDR ILRLVKSLSP KVLTLVEQES  420
NTNTAPFAQR FAETLDYYTA IFESIDLALP REDRERINME QHCLAREIVN LVACEGEERV  480
ERHEVFGKWK ARLMMAGFRP SPLSALVNAT IKTLLQSYSP DYKLAERDGV LYLGWKNRPL  540
IVSSAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-661815478375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0639280.0BT063928.1 Zea mays full-length cDNA clone ZM_BFc0120M18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958142.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 2
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLK3ZS380.0K3ZS38_SETIT; Uncharacterized protein
STRINGSi029418m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein